ERp57 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ERp57 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ERp57 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; how |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [Protein disulfide-isomerase A3; 58 kDa glucose regulated protein; 58 kDa glucose-regulated protein; 58 kDa microsomal protein; Disulfide isomerase ER 60; Disulfide isomerase ER-60; Endoplasmic reticulum resident protein 57; Endoplasmic reticulum resident protein 60; ER p57; ER protein 57; ER protein 60; ERp 57; ERp57; ERp60; ERp61; Glucose Regulated Protein 58 Kd; GRP 57; GRP 58; GRP57; GRP58; HsT17083; P58; PDIA 3; PDIA3; PDIA3_HUMAN; Phospholipase C alpha; PI PLC; Protein disulfide isomerase A3; Protein disulfide isomerase family A member 3; Protein disulfide-isomerase A3; protein disulfide isomerase family A, member 3], [PDIA3; PDIA3; P58; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; PI-PLC; HsT17083; HEL-S-269; HEL-S-93n; ERP57; ERP60; GRP58; p58; ER protein 57; ERp57; ER protein 60; ERp60] |
| Gene, Accession # | [ERp57], Gene ID: 2923, NCBI: NP_005304.3, UniProt: P30101 |
| Catalog # | MBS177878 |
| Price | $315 |
| Order / More Info | ERp57 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: PDIA3 protein disulfide isomerase family A, member 3. 2. Ellerman, D. A., Myles, D. G., Primakoff, P. A role for sperm surface protein disulfide isomerase activity in gamete fusion: evidence for the participation of ERp57. Dev. Cell 10: 831-837, 2006 3. Garbi, N., Tanaka, S., Momburg, F., Hammerling, G. J. Impaired assembly of the major histocompatibility complex class I peptide-loading complex in mice deficient in the oxidoreductase ERp57. Nature Immun. 7: 93-102, 2006. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies