Insulin Receptor Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Insulin Receptor antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Insulin Receptor |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection. Background: INSR(INSULIN RECEPTOR) is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Insulin Receptor (38-76aa MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL), identical to the related mouse and rat sequences. |
| Other Names | [CD 220; CD220; HHF5; HIR A; insulin receptor; INSR alpha; insulin receptor a; Insulin Receptor alpha; Insulin receptor subunit alpha; Insulin receptor subunit beta; Insulin receptor(IR); InsulinReceptor; Insulinreceptor(IR); IR 1; P06213], [INSR; INSR; HHF5; CD220; IR] |
| Gene, Accession # | [INSR], Gene ID: 3643, NCBI: NP_000199.2, UniProt: P06213 |
| Catalog # | MBS178828 |
| Price | $280 |
| Order / More Info | Insulin Receptor Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Accili, D., Drago, J., Lee, E. J., Johnson, M. D., Cool, M. H., Salvatore, P., Asico, L. D., Jose, P. A., Taylor, S. I., Westphal, H. Early neonatal death in mice homozygous for a null allele of the insulin receptor gene. Nature Genet. 12: 106-109, 1996.2. 't Hart, L. M., Stolk, R. P., Dekker, J. M., Nijpels, G., Grobbee, D. E., Heine, R. J., Maassen, J. A. Prevalence of variants in candidate genes for type 2 diabetes mellitus in the Netherlands: the Rotterdam study and the Hoorn study. J. Clin. Endocr. Metab. 84: 1002-1006, 1999.3. Ward CW, Lawrence MC (April 2009). Ligand-induced activation of the insulin receptor: a multi-step process involving structural changes in both the ligand and the receptor. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies