P Glycoprotein/ABCB1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-P Glycoprotein/ABCB1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | P Glycoprotein/ABCB1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for P Glycoprotein detection. Tested with WB in Human; Mouse; Rat.Background: P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY). |
| Other Names | [Multidrug resistance protein 1; ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243; ABCB1; MDR1; PGY1] |
| Gene, Accession # | [ABCB1], Gene ID: 5243, NCBI: NP_000918.2, UniProt: P08183 |
| Catalog # | MBS1751202 |
| Price | $280 |
| Order / More Info | P Glycoprotein/ABCB1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Aller SG, Yu J, Ward A, Weng Y, Chittaboina S, Zhuo R, Harrell PM, Trinh YT, Zhang Q, Urbatsch IL, Chang G (March 2009). 2. Ueda K, Clark DP, Chen CJ, Roninson IB, Gottesman MM, Pastan I (January 1987). The human multidrug resistance (mdr1) gene. cDNA cloning and transcription initiation. J. Biol. Chem.262 (2): 505-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies