Edit |   |
---|---|
Antigenic Specificity | APH1a |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human, mouse |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1(APH1A) detection. Tested with WB in Human;Mouse. Background: APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid. Ig Type: Rabbit IgG |
Other Names | [Gamma-secretase subunit APH-1; 6530402N02Rik; AL138795.3; Anterior Pharynx Defective 1; Anterior pharynx defective 1 homolog A; APH 1A; Aph 1alpha; APH-1a; Aph-1alpha; Aph1a; APH1A gamma secretase subunit; APH1A_HUMAN; CGI 78; CGI78; Gamma secretase subunit APH 1A; Gamma Secretase Subunit APH1a; Gamma-secretase subunit APH-1A; Likely ortholog of C. elegans anterior pharynx defective 1A; Presenilin Stabilization Factor; Presenilin-stabilization factor; PSF; UNQ579/PRO1141; APH1A gamma secretase subunit], [APH1A; APH1A; APH-1; APH-1A; CGI-78; 6530402N02Rik; PSF; APH-1a] |
Gene, Accession # | [APH1A], Gene ID: 51107, NCBI: NP_001071096.1, UniProt: Q96BI3 |
Catalog # | MBS178259 |
Price | $280 |
Order / More Info | APH1a Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Qin W; Jia L; Zhou A; Zuo X; Cheng Z; Wang F; Shi F; Jia J: The -980C/G polymorphism in APH-1A promoter confers risk of Alzheimer's disease. Aging Cell, 2011 Aug. |