Argonaute 4 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Argonaute 4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Argonaute 4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Protein argonaute-4 (AGO4) detection. Background: AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence. |
| Other Names | [Ago 4; Ago4; Argonaute4 |Argonaute 4; Argonaute-4; EIF 2C 4; eIF-2C 4; eIF2C 4; eif2c4; hAgo4; KIAA1567; Protein argonaute-4; Q9HCK5; Protein argonaute-4; argonaute 4, RISC catalytic component], [AGO4; AGO4; EIF2C4; EIF2C4; KIAA1567; Argonaute4; hAgo4; eIF-2C 4; eIF2C 4] |
| Gene, Accession # | [AGO4], Gene ID: 192670, NCBI: NP_060099.2, UniProt: Q9HCK5 |
| Catalog # | MBS178479 |
| Price | $280 |
| Order / More Info | Argonaute 4 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Carmell, M. A., Xuan, Z., Zhang, M. Q., Hannon, G. J. The argonaute family: tentacles that reach into RNAi, developmental control, stem cell maintenance, and tumorigenesis. Genes Dev. 16: 2733-2742, 2002.2. Nagase, T., Kikuno, R., Nakayama, M., Hirosawa, M., Ohara, O. Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 7: 273-281, 2000. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies