Edit |   |
---|---|
Antigenic Specificity | FGD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.77 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of faciogenital dysplasia and X-linked mental retardation, syndromatic 16. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP 004454.2). Immunogen Sequence: LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS |
Other Names | [FGD1; AAS; FGDY; MRXS16; ZFYVE3; FYVE, RhoGEF and PH domain containing 1] |
Gene, Accession # | [FGD1], Gene ID: 2245, NCBI: NP_004454.2, UniProt: P98174 |
Catalog # | MBS9140973 |
Price | $260 |
Order / More Info | FGD1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |