Edit |   |
---|---|
Antigenic Specificity | C20ORF111 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: C20ORF111 antibody was raised against the N terminal Of C20Orf111. Rabbit polyclonal C20ORF111 antibody raised against the N terminal Of C20Orf111 |
Immunogen | Immunogen: C20ORF111 antibody was raised using the N terminal Of C20Orf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG |
Other Names | [C20ORF111; C20ORF111; Chromosome ORF-20; Chromosome ORF 20; HSPC207; Chromosome 20 ORF; dJ1183I21.1; Perit1], [OSER1; OSER1; Osr1; Perit1; HSPC207; C20orf111; dJ1183I21.1; C20orf111] |
Gene, Accession # | [C20ORF111], Gene ID: 51526, NCBI: EAW75939.1 |
Catalog # | MBS839055 |
Price | $430 |
Order / More Info | C20ORF111 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |