StAR Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-StAR Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | StAR Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.Protein Function: Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transf |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human StAR (EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD). Subcellular Localization: Mitochondrion. Tissue Specificity: Expressed in gonads, adrenal cortex and kidney. |
| Other Names | [Steroidogenic acute regulatory protein; mitochondrial; StAR; START domain-containing protein 1; StARD1; STAR; STARD1] |
| Gene, Accession # | [StAR], Gene ID: 6770, NCBI: NP_000340.2, UniProt: P49675 |
| Catalog # | MBS1750318 |
| Price | $280 |
| Order / More Info | StAR Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies