SLC18A3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SLC18A3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SLC18A3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection. Background: The Vesicular acetylcholine transporter (VAChT), also known as SLC18A3, is a neurotransmitter transporter which is responsible for loadingacetylcholine (ACh) into secretory organelles in neurons making acetylcholine available for secretion. It is encoded by Solute carrier family 18, member 3 (SLC18A3) gene. This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline ace |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL), different from the related mouse and rat sequences by five amino acids. |
| Other Names | [AChR; Rvat; Slc18a3; VAChT; Q16572; Vesicular acetylcholine transporter; solute carrier family 18 member A3], [SLC18A3; SLC18A3; CMS21; VACHT; VACHT; VAChT] |
| Gene, Accession # | [SLC18A3], Gene ID: 6572, NCBI: NP_003046.2, UniProt: Q16572 |
| Catalog # | MBS178692 |
| Price | $280 |
| Order / More Info | SLC18A3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Erickson JD, Varoqui H (Dec 2000). Molecular analysis of vesicular amine transporter function and targeting to secretory organelles. FASEB Journal. 14 (15): 2450-8.2. Weihe E, Tao-Cheng JH, Schafer MK, Erickson JD, Eiden LE (Apr 1996). Visualization of the vesicular acetylcholine transporter in cholinergic nerve terminals and its targeting to a specific population of small synaptic vesicles. Proceedings of the National Academy of Sciences of the United States of America. 93 (8): 3547-52. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies