CD18 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CD18 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CD18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Integrin beta-2(ITGB2) detection. Tested with WB, IHC-P in Human. Background: The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, I |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD18 (24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids. |
| Other Names | [Integrin beta-2; integrin, beta 2(complement component 3 receptor 3 and 4 subunit); 95 subunit beta; CD 18; CD18; Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor); Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta; Cell surface adhesion glycoproteins LFA-1/CR3/p150; Complement receptor C3 beta subunit; Complement receptor C3 subunit beta; Integrin beta 2; Integrin beta chain beta 2; Integrin beta-2; Integrin, beta 2(complement component 3 receptor 3 and 4 subunit); ITB2_HUMAN; ITGB2; LAD; LCAMB; Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C; Leukocyte cell adhesion molecule CD18; LFA 1; LFA1; Lymphocyte function associated antigen 1; MAC 1; MAC1; MF17; MFI7; OTTHUMP00000115278; OTTHUMP00000115279; OTTHUMP00000115280; OTTHUMP00000115281; OTTHUMP00000115282], [ITGB2; ITGB2; LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1; CD18; MFI7] |
| Gene, Accession # | [ITGB2], Gene ID: 3689, NCBI: P05107.2, UniProt: P05107 |
| Catalog # | MBS175688 |
| Price | $280 |
| Order / More Info | CD18 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies