Edit |   |
---|---|
Antigenic Specificity | CPNE1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.93 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human CPNE1 (NP 003906.2). Immunogen Sequence: MLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDY |
Other Names | [CPNE1; COPN1; CPN1; copine-1] |
Gene, Accession # | [CPNE1], Gene ID: 8904, NCBI: NP_001185792.1, UniProt: Q99829 |
Catalog # | MBS9140473 |
Price | $260 |
Order / More Info | CPNE1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |