Thrombin Receptor Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Thrombin Receptor antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Thrombin Receptor |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 1(F2R) detection. Tested with WB, IHC-P in Human. Background: Proteinase-activated receptor 1 (PAR1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK). Ig Type: Rabbit IgG |
| Other Names | [Proteinase-activated receptor 1; CF2R; Coagulation factor II (thrombin) receptor; Coagulation factor II receptor; F2R; HTR; PAR 1; PAR-1; PAR1; PAR1_HUMAN; Protease activated receptor 1; Proteinase activated receptor 1; Proteinase-activated receptor 1; Thrombin receptor; TR; coagulation factor II (thrombin) receptor], [F2R; F2R; TR; HTR; CF2R; PAR1; PAR-1; CF2R; PAR1; TR; PAR-1] |
| Gene, Accession # | Gene ID: 2149, NCBI: NP_001298242.1, UniProt: P25116 |
| Catalog # | MBS178197 |
| Price | $315 |
| Order / More Info | Thrombin Receptor Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Bahou, W. F., Nierman, W. C., Durkin, A. S., Potter, C. L., Demetrick, D. J. Chromosomal assignment of the human thrombin receptor gene: localization to region q13 of chromosome 5. Blood 82: 1532-1537, 1993. 2. Boire, A., Covic, L., Agarwal, A., Jacques, S., Sherifi, S., Kuliopulos, A. PAR1 is a matrix metalloprotease-1 receptor that promotes invasion and tumorigenesis of breast cancer cells. Cell 120: 303-131, 2005. 3. Coughlin, S. R., Vu, T.-K. H., Hung, D. T., Wheaton, V. I. Characterization of a functional thrombin receptor: issues and opportunities. J. Clin. Invest. 89: 351-355, 1992. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies