Edit |   |
---|---|
Antigenic Specificity | REM1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal REM1 antibody |
Immunogen | Immunogen: REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT |
Other Names | [REM1; REM1; Ras; REM-1; REM 1; REM; GD:REM; Rad And Gem-Like Gtp-Binding 1; GES; MGC48669; REM1] |
Gene, Accession # | [REM1], NCBI: AIJ28973.1 |
Catalog # | MBS5302539 |
Price | $430 |
Order / More Info | REM1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |