AP2M1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-AP2M1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | AP2M1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection. Background: AP-2 complex subunit mu is a protein that in humans is encoded by the AP2M1 gene. This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences. |
| Other Names | [Adaptin mu 1; Adaptin-mu2; AP 2 mu 2 chain; AP-2 complex subunit mu; Ap2m1; AP50; CLAPM1; Q96CW1; AP-2 complex subunit mu; adaptor related protein complex 2 mu 1 subunit], [AP2M1; AP2M1; mu2; AP50; CLAPM1; CLAPM1; KIAA0109] |
| Gene, Accession # | [AP2M1], Gene ID: 1173, NCBI: NP_001020376.1, UniProt: Q96CW1 |
| Catalog # | MBS178700 |
| Price | $280 |
| Order / More Info | AP2M1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: AP2M1 adaptor-related protein complex 2, mu 1 subunit.2. Druck T, Gu Y, Prabhala G, Cannizzaro LA, Park SH, Huebner K, Keen JH (Nov 1995). Chromosome localization of human genes for clathrin adaptor polypeptides AP2 beta and AP50 and the clathrin-binding protein, VCP. Genomics. 30 (1): 94-7.3. Follows ER, McPheat JC, Minshull C, Moore NC, Pauptit RA, Rowsell S, Stacey CL, Stanway JJ, Taylor IW, Abbott WM (Oct 2001). Study of the interaction of the medium chain mu 2 subunit of the clathrin-associated adapter protein complex 2 with cytotoxic T-lymphocyte antigen 4 and CD28. The Biochemical Journal. 359 (Pt 2): 427-34. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies