ZBTB7A Antibody from MYBIOSOURCE INC.

Search, find, compare suppliers for anti-ZBTB7A antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityZBTB7A
Clonepolyclonal
Host Speciesn/a
Reactive Specieshuman
Isotypen/a
Formatimmunogen affinity purified
Size0.1 mg
Concentrationn/a
ApplicationsWestern Blot (WB), Immunohistochemistry (IHC) Paraffin
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionDescription: Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Human. Background: Zinc finger and BTB domain-containing protein 7A is a protein that in humans is encoded by the ZBTB7A gene. ZBTB7A has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targe
ImmunogenImmunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids. Ig Type: Rabbit IgG
Other Names[Zinc finger and BTB domain-containing protein 7A; DKFZp547O146; Factor binding IST protein 1; Factor that binds to inducer of short transcripts protein 1; FBI-1; FBI1; HIV-1 1st-binding protein 1; HIV-1 inducer of short transcripts binding protein; HIV-1 inducer of short transcripts-binding factor 1; Leukemia/lymphoma-related factor; LRF; lymphoma related factor; MGC99631; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF-I-interacting peptide 21; ZBT7A_HUMAN; ZBTB7; ZBTB7A; Zinc finger and BTB domain containing 7A; zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein; Zinc finger and BTB domain-containing protein 7A; Zinc finger protein 857A; Zinc finger- and BTB domain-containing protein 7; ZNF857A; zinc finger and BTB domain containing 7A], [ZBTB7A; ZBTB7A; LRF; FBI1; FBI-1; TIP21; ZBTB7; ZNF857A; pokemon; FBI1; LRF; ZBTB7; ZNF857A; FBI-1; POK erythroid myeloid ontogenic factor; Pokemon; TIP21]
Gene, Accession #[ZBTB7A], Gene ID: 51341, NCBI: NP_001304919.1, UniProt: O95365
Catalog #MBS177802
Price$315
Order / More InfoZBTB7A Antibody from MYBIOSOURCE INC.
Product Specific References1. Entrez Gene: ZBTB7A zinc finger and BTB domain containing 7A. 2. Wang, G., Lunardi, A., Zhang, J., Chen, Z., Ala, U., Webster, K. A., Tay, Y., Gonzalez-Billalabeitia, E., Egia, A., Shaffer, D. R., Carver, B., Liu, X.-S., Taulli, R., Kuo, W. P., Nardella, C., Signoretti, S., Cordon-Cardo, C., Gerald, W. L., Pandolfi, P. P. Zbtb7a suppresses prostate cancer through repression of a Sox9-dependent pathway for cellular senescence bypass and tumor invasion. Nature Genet. 45: 739-746, 2013.
MYBIOSOURCE INC.
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166

sales@mybiosource.com

http://www.MyBioSource.com

Profile of MYBIOSOURCE INC.
Return to Antibodies

© 1980 - 2024 Linscott's Directory, Linscott's USA. All rights reserved.