FAH - C-terminal region Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-FAH - C-terminal region antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | FAH - C-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse; predicted: cow, dog, guinea pig, horse, human, mouse, rabbit, rat, zebrafish |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 0.1 mL |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description of Target: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). |
| Immunogen | Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAH Peptide Sequence: Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG Protein Name: Fumarylacetoacetase Protein Interactions: KRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR; Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
| Other Names | [fumarylacetoacetase; Fumarylacetoacetase; fumarylacetoacetase; fumarylacetoacetate hydrolase; Beta-diketonase; Fumarylacetoacetate hydrolase] |
| Gene, Accession # | [FAH], Gene ID: 2184, NCBI: NP_000128, UniProt: P16930 |
| Catalog # | MBS3205975 |
| Price | $290 |
| Order / More Info | FAH - C-terminal region Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies