HtrA3 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-HtrA3 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | HtrA3 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.Protein Function: Serine protease that cleaves beta-casein/CSN2 as well as several extracellular mat |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. Subcellular Localization: Secreted. Secretion increased during decidualization of endometrial stromal cells. Tissue Specificity: Widely expressed, with highest levels in both adult and fetal heart, ovary, uterus placenta, and bladder. In the |
| Other Names | [Serine protease HTRA3; 3.4.21.-; High-temperature requirement factor A3; Pregnancy-related serine protease; HTRA3; PRSP] |
| Gene, Accession # | [HtrA3], Gene ID: 94031, NCBI: NP_001284488.1, UniProt: P83110 |
| Catalog # | MBS1750899 |
| Price | $280 |
| Order / More Info | HtrA3 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies