CHRNA5 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CHRNA5 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CHRNA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Neuronal acetylcholine receptor subunit alpha-5(CHRNA5) detection. Background: Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2). |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids. |
| Other Names | [AChR; CHRNA 5; CHRNA5; LNCR2; NACHRA 5; NACHRA5; P30532; Neuronal acetylcholine receptor subunit alpha-5; cholinergic receptor nicotinic alpha 5 subunit], [CHRNA5; CHRNA5; LNCR2; NACHRA5] |
| Gene, Accession # | [CHRNA5], Gene ID: 1138, NCBI: NP_000736.2, UniProt: P30532 |
| Catalog # | MBS178666 |
| Price | $315 |
| Order / More Info | CHRNA5 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: CHRNA5 cholinergic receptor, nicotinic, alpha 5.2. Chini, B., Clementi, F., Hukovic, N., Sher, E. Neuronal-type alpha-bungarotoxin receptors and the alpha-5-nicotinic receptor subunit gene are expressed in neuronal and nonneuronal human cell lines. Hum. Genet. 89: 1572-1576, 1992.3. Wang, J. C., Cruchaga, C., Saccone, N. L., Bertelsen, S., Liu, P., Budde, J. P., Duan, W., Fox, L., Grucza, R. A., Kern, J., Mayo, K., Reyes, O., and 12 others. Risk for nicotine dependence and lung cancer is conferred by mRNA expression levels and amino acid change in CHRNA5. Hum. Molec. Genet. 18: 3125-3135, 2009. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies