Edit |   |
---|---|
Antigenic Specificity | HNRPH3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal HNRPH3 antibody |
Immunogen | Immunogen: HNRPH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY |
Other Names | [HNRPH3; HNRPH3; HNRPH-3; HNRPH 3; Heterogeneous Nuclear Ribonucleoprotein H3; HNRPH3], [HNRNPH3; HNRNPH3; 2H9; HNRPH3; HNRPH3; hnRNP H3; hnRNP 2H9] |
Gene, Accession # | [HNRPH3], Gene ID: 3189, NCBI: NP_067676.2 |
Catalog # | MBS839223 |
Price | $355 |
Order / More Info | HNRPH3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |