Edit |   |
---|---|
Antigenic Specificity | Aquaporin 2 |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Aquaporin-2(AQP2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell. The AQP2 gene is mapped to chromosome 12q13, very close to the site of major intrinsic protein by situ hybridization. The investigators suggested that a defect in the AQP2 gene is the basis of the autosomal form of nephrogenic diabetes insipidus. The functional expression and the limited localization suggested that AQP2 is the vasopressin-regulated water channel. Using rat kidney slices and porcine kidney cells stably expres |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid. Ig Type: Rabbit IgG |
Other Names | [Aquaporin-2; ADH water channel; AQP 2; AQP CD; AQP-2; AQP-CD; AQP2; AQP2_HUMAN; AQPCD; Aquaporin 2 collecting duct; Aquaporin CD; Aquaporin-2; Aquaporin-CD; Aquaporin2; Aquaporine 2; Collecting duct water channel protein; MGC34501; Water channel aquaporin 2; Water channel protein for renal collecting duct; WCH CD; WCH-CD; WCHCD; aquaporin 2 (collecting duct)], [AQP2; AQP2; AQP-CD; WCH-CD; AQP-2; AQP-CD] |
Gene, Accession # | Gene ID: 359, NCBI: NP_000477.1, UniProt: P41181 |
Catalog # | MBS178069 |
Price | $315 |
Order / More Info | Aquaporin 2 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Bouley, R., Breton, S., Sun, T., McLaughlin, M., Nsumu, N. N., Lin, H. Y., Ausiello, D. A., Brown, D. Nitric oxide and atrial natriuretic factor stimulate cGMP-dependent membrane insertion of aquaporin 2 in renal epithelial cells. J. Clin. Invest. 106: 1115-1126, 2000. 2. Canfield, M. C., Tamarappoo, B. K., Moses, A. M., Verkman, A. S., Holtzman, E. J. Identification and characterization of aquaporin-2 water channel mutations causing nephrogenic diabetes insipidus with partial vasopressin response. Hum. Molec. Genet. 6: 1865-1871, 1997. 3. Deen, P. M. T., Croes, H., van Aubel, R. A. M. H., Ginsel, L. A., van Os, C. H. Water channels encoded by mutant aquaporin-2 genes in nephrogenic diabetes insipidus are impaired in their cellular routing. J. Clin. Invest. 95: 2291-2296, 1995. |