PGRMC1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PGRMC1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PGRMC1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Membrane-associated progesterone receptor component 1(PGRMC1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Progesterone receptor membrane component 1 (PGRMC1) is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the PGRMC1 protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67-102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK), identical to the related mouse sequence, and different from the related rat sequence by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [Membrane-associated progesterone receptor component 1; HPR6.6; Membrane associated progesterone receptor component 1; Membrane-associated progesterone receptor component 1; mPR; PGRC1_HUMAN; PGRMC; Pgrmc1; Progesterone binding protein; Progesterone receptor membrane component 1; progesterone receptor membrane component 1], [PGRMC1; PGRMC1; MPR; HPR6.6; HPR6.6; PGRMC; mPR] |
| Gene, Accession # | [PGRMC1], Gene ID: 10857, NCBI: NP_001269550.1, UniProt: O00264 |
| Catalog # | MBS178188 |
| Price | $315 |
| Order / More Info | PGRMC1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Gerdes D, Wehling M, Leube B, Falkenstein E (Jul 1998). Cloning and tissue expression of two putative steroid membrane receptors.Biological Chemistry 379 (7): 907-11. 2. Meyer C, Schmid R, Scriba PC, Wehling M (Aug 1996). Purification and partial sequencing of high-affinity progesterone-binding site(s) from porcine liver membranes. European Journal of Biochemistry / FEBS 239(3): 726-31. 3. Xu J, Zeng C, Chu W, Pan F, Rothfuss JM, Zhang F, Tu Z, Zhou D, Zeng D, Vangveravong S, Johnston F, Spitzer D, Chang KC, Hotchkiss RS, Hawkins WG, Wheeler KT, Mach RH (2011). Identification of the PGRMC1 protein complex as the putative sigma-2 receptor binding site. Nature Communications 2 (2): 380. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies