Edit |   |
---|---|
Antigenic Specificity | DRB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: DRB1 antibody was raised against the N terminal of DRB1. Rabbit polyclonal DRB1 antibody raised against the N terminal of DRB1 |
Immunogen | Immunogen: DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD |
Other Names | [DRB1; DRB1; Developmentally Regulated Rna-Binding Protein 1], [HLA-DRB1; DR-1; DR1] |
Gene, Accession # | [DRB1], NCBI: CAA68171.1, UniProt: P04229 |
Catalog # | MBS839853 |
Price | $355 |
Order / More Info | DRB1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |