p95 NBS1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-p95 NBS1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | p95 NBS1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: p95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50(N/M/R, more commonly referred to asMRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand br |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids. Ig Type: Rabbit IgG |
| Other Names | [Nibrin; AT V1; AT V2; ATV; ATV; Cell cycle regulatory protein p95; FLJ10155; MGC87362; NBN; NBN_HUMAN; NBS 1; NBS; NBS; NBS1; Nibrin; Nibrin; Nijmegen breakage syndrome 1 (nibrin); Nijmegen breakage syndrome; Nijmegen breakage syndrome protein 1; p95; p95; p95 protein of the MRE11/RAD50 complex; nibrin], [NBN; NBN; ATV; NBS; P95; NBS1; AT-V1; AT-V2; NBS; NBS1; P95] |
| Gene, Accession # | [p95 NBS1], Gene ID: 4683, NCBI: NP_001019859.1, UniProt: O60934 |
| Catalog # | MBS177831 |
| Price | $315 |
| Order / More Info | p95 NBS1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Atlas of Genetics and Cytogenetics in Oncology and Haematology - NBS1. 2. Carney JP, Maser RS, Olivares H, Davis EM, Le Beau M, Yates JR, Hays L, Morgan WF, Petrini JH (May 1998). The hMre11/hRad50 protein complex and Nijmegen breakage syndrome: linkage of double-strand break repair to the cellular DNA damage response. Cell 93 (3): 477-86. 3. Varon R, Vissinga C, Platzer M, Cerosaletti KM, Chrzanowska KH, Saar K, Beckmann G, Seemanova E, Cooper PR, Nowak NJ, Stumm M, Weemaes CM, Gatti RA, Wilson RK, Digweed M, Rosenthal A, Sperling K, Concannon P, Reis A (May 1998). Nibrin, a novel DNA double-strand break repair protein, is mutated in Nijmegen breakage syndrome. Cell 93 (3): 467-76. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies