Edit |   |
---|---|
Antigenic Specificity | ITGA1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.97 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes the alpha 1 subunit of integrin receptors. This protein heterodimerizes with the beta 1 subunit to form a cell-surface receptor for collagen and laminin. The heterodimeric receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. The alpha 1 subunit contains an inserted (I) von Willebrand factor type I domain which is thought to be involved in collagen binding. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ITGA1 (NP 852478.1). Immunogen Sequence: ATVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFNLTDPENGPVLDDSLPNSVHE |
Other Names | [ITGA1; CD49a; VLA1; integrin alpha-1] |
Gene, Accession # | [ITGA1], Gene ID: 3672, NCBI: P56199.2, UniProt: P56199 |
Catalog # | MBS9140692 |
Price | $260 |
Order / More Info | ITGA1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |