Doppel/PRND Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Doppel/PRND antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Doppel/PRND |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH). |
| Other Names | [Prion-like protein doppel; PrPLP; Prion protein 2; PRND; DPL; UNQ1830/PRO3443; Prion like protein doppel] |
| Gene, Accession # | [PRND], Gene ID: 23627, NCBI: NP_036541.2, UniProt: Q9UKY0 |
| Catalog # | MBS1751490 |
| Price | $315 |
| Order / More Info | Doppel/PRND Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Comincini, S., Foti, M. G., Tranulis, M. A., Hills, D., Di Guardo, G., Vaccari, G., Williams, J. L., Harbitz, I., Ferretti, L. Genomic organization, comparative analysis, and genetic polymorphisms of the bovine and ovine prion Doppel genes (PRND). Mammalian Genome 12: 729-733, 2001. 2. Croes, E. A., Alizadeh, B. Z., Bertoli-Avella, A. M., Rademaker, T., Vergeer-Drop, J., Dermaut, B., Houwing-Duistermaat, J. J., Wientjens, D. P. W. M., Hofman, A., Van Broeckhoven, C., van Duijn, C. M. Polymorphisms in the prion protein gene and in the doppel gene increase susceptibility for Creutzfeldt-Jakob disease. Europ. J. Hum. Genet. 12: 389-394, 2004. 3. Genoud, N., Behrens, A., Miele, G., Robay, D., Heppner, F. L., Freigang, S., Aguzzi, A.Disruption of Doppel prevents neurodegeneration in mice with extensive Prnp deletions.Proc. Nat. Acad. Sci. 101: 4198-4203, 2004. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies