Edit |   |
---|---|
Antigenic Specificity | SKIV2L |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal SKIV2L antibody |
Immunogen | Immunogen: SKIV2L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP |
Other Names | [SKIV2L; SKIV2L; HLP; SKIVL-2; SKIV2L; SKIV2; SKIVL 2; Superkiller Viralicidic Activity 2-Like; SKI2W; SKI2; DDX13; 170A] |
Gene, Accession # | [SKIV2L], Gene ID: 108077, NCBI: AAH23478.1 |
Catalog # | MBS5301911 |
Price | $430 |
Order / More Info | SKIV2L Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |