ADRA1A Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ADRA1A antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ADRA1A |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Alpha-1A adrenergic receptor(ADRA1A) detection. Tested with WB in Human;Mouse;Rat. Background: ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Alpha-1A adrenergic receptor; ADA1D_HUMAN; Adra1; Adra1a; Adra1d; ADRA1R; Adrd1; Adrenergic alpha1A receptor; Adrenergic alpha1D receptor; Adrenergic receptor alpha 1d; Adrenergic receptor delta1; Adrenoceptor alpha 1D; Alpha 1D adrenoceptor; Alpha 1D adrenoreceptor; Alpha adrenergic receptor 1a; Alpha-1A adrenergic receptor; Alpha-1D adrenergic receptor; Alpha-1D adrenoceptor; Alpha-1D adrenoreceptor; Alpha-adrenergic receptor 1a; ALPHA1; Alpha1A adrenergic receptor; Alpha1D adrenergic receptor; Alpha1DAR; DAR; dJ779E11.2; Gpcr8; RA42; Spr8; adrenoceptor alpha 1A], [ADRA1A; ADRA1A; ADRA1C; ADRA1L1; ALPHA1AAR; ADRA1C; Alpha-1A adrenoceptor] |
| Gene, Accession # | [ADRA1A], Gene ID: 148, NCBI: NP_000671.2, UniProt: P35348 |
| Catalog # | MBS178268 |
| Price | $280 |
| Order / More Info | ADRA1A Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Hirasawa, A., Horie, K., Tanaka, T., Takagaki, K., Murai, M., Yano, J., Tsujimoto, G.Cloning, functional expression and tissue distribution of human cDNA for the alpha-1C-adrenergic receptor. Biochem. Biophys. Res. Commun. 195: 902-909, 1993. 2. Langer SZ (1998). Nomenclature and state of the art on alpha1-adrenoceptors. Eur. Urol. 33 Suppl 2: 2-6. 3. Weinberg, D. H., Trivedi, P., Tan, C. P., Mitra, S., Perkins-Barrow, A., Borkowski, D., Strader, C. D., Bayne, M. Cloning, expression and characterization of human alpha adrenergic receptors alpha-1A, alpha-1B, and alpha-1C. Biochem. Biophys. Res. Commun. 201: 1296-1304, 1994. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies