Edit |   |
---|---|
Antigenic Specificity | SLC9A1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal SLC9A1 antibody |
Immunogen | Immunogen: SLC9A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG |
Other Names | [SLC9A1; SLC9A1; NHE1; SLC9A1; SLCA1-9; SLCA1 9; FLJ42224; APNH; Solute Carrier Family 9 Member 1; Sodium/Hydrogen Exchanger 1] |
Gene, Accession # | [SLC9A1], Gene ID: 6548, NCBI: AAH12121.1 |
Catalog # | MBS5302601 |
Price | $430 |
Order / More Info | SLC9A1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |