MEK3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-MEK3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | MEK3 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)(MAP2K3) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS onc |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence. Ig Type: Rabbit IgG |
| Other Names | [Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3); AW212142; Dual specificity mitogen activated protein kinase kinase 3; Dual specificity mitogen-activated protein kinase kinase 3; ERK kinase 3; MAP kinase kinase 3; MAP2K 3; map2k3; MAPK ERK kinase 3; MAPK kinase 3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; MEK3; Mitogen activated protein kinase kinase 3; MKK 3; MKK3; mMKK 3b; mMKK3b; MP2K3_HUMAN; MPK 3; PRKMK 3; PRKMK3; Protein kinase mitogen activated kinase 3; protein kinase, mitogen-activated, kinase 3; SAPK kinase 2; SAPKK 2; SAPKK2; SKK2; Stress activated protein kinase kinase 2; zMKK 3; mitogen-activated protein kinase kinase 3], [MAP2K3; MAP2K3; MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2; MEK3; MKK3; PRKMK3; SKK2; MAP kinase kinase 3; MAPKK 3; MEK 3; SAPK kinase 2; SAPKK-2; SAPKK2] |
| Gene, Accession # | [MEK3], Gene ID: 5606, NCBI: NP_001303261.1, UniProt: P46734 |
| Catalog # | MBS177922 |
| Price | $315 |
| Order / More Info | MEK3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Rampoldi L, Zimbello R, Bortoluzzi S, Tiso N, Valle G, Lanfranchi G, Danieli GA (Mar 1998). Chromosomal localization of four MAPK signaling cascade genes: MEK1, MEK3, MEK4 and MEKK5. Cytogenet Cell Genet 78 (3-4): 301-3. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies