CDK19 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CDK19 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CDK19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.1 mL |
| Concentration | 0.77 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CDK19 (XP 005266928.1). Immunogen Sequence: QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS |
| Other Names | [CDK19; CDC2L6; CDK11; bA346C16.3; cyclin-dependent kinase 19] |
| Gene, Accession # | [CDK19], Gene ID: 23097, NCBI: NP_055891.1, UniProt: Q9BWU1 |
| Catalog # | MBS9140720 |
| Price | $260 |
| Order / More Info | CDK19 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies