Edit |   |
---|---|
Antigenic Specificity | GADD45G |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Growth arrest and DNA-damage-inducible protein GADD45 gamma is a protein that in humans is encoded by the GADD45G gene on chromosome 9. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.Protein Function: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human GADD45G (MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ). |
Other Names | [Growth arrest and DNA damage-inducible protein GADD45 gamma; Cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein; DDIT-2; GADD45G; CR6; DDIT2] |
Gene, Accession # | [GADD45G], Gene ID: 10912, NCBI: NP_006696.1, UniProt: O95257 |
Catalog # | MBS1750880 |
Price | $280 |
Order / More Info | GADD45G Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |