SLC17A7 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SLC17A7 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SLC17A7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.1 mL |
| Concentration | 3.47 mg/ml |
| Applications | Western Blot (WB), Immunofluorescence (IF) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family. |
| Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP 064705.1). Immunogen Sequence: KHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY |
| Other Names | [SLC17A7; BNPI; VGLUT1; vesicular glutamate transporter 1] |
| Gene, Accession # | [SLC17A7], Gene ID: 57030, NCBI: NP_064705.1, UniProt: Q9P2U7 |
| Catalog # | MBS9141062 |
| Price | $260 |
| Order / More Info | SLC17A7 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies