CD5 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CD5 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CD5 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.Protein Function: May act as a receptor in regulating T-cell proliferation. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). Subcellular Localization: Cell membrane; Single-pass type I membrane protein. |
| Other Names | [T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD5; CD5; LEU1] |
| Gene, Accession # | [CD5], Gene ID: 921, NCBI: NP_001333385.1, UniProt: P06127 |
| Catalog # | MBS1750420 |
| Price | $315 |
| Order / More Info | CD5 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies