Edit |   |
---|---|
Antigenic Specificity | MAGEH1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.27 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene belongs to the non-CT (non cancer/testis) subgroup of the melanoma-associated antigen (MAGE) superfamily. The encoded protein is likely associated with apoptosis, cell cycle arrest, growth inhibition or cell differentiation. The protein may be involved in the atRA (all-trans retinoic acid) signaling through the STAT1-alpha (signal transducer and activator of transcription 1-alpha) pathway. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human MAGEH1 (NP 054780.2). Immunogen Sequence: RRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVPRSNFQGTKKS |
Other Names | [MAGEH1; APR-1; APR1; MAGEH; MAGE family member H1] |
Gene, Accession # | [MAGEH1], Gene ID: 28986, NCBI: NP_054780.2, UniProt: Q9H213 |
Catalog # | MBS9141053 |
Price | $260 |
Order / More Info | MAGEH1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |