SFTPA1/2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SFTPA1/2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SFTPA1/2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Formalin/Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat. Background: SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes enc |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids. Ig Type: Rabbit IgG |
| Other Names | [Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2; 35 kDa pulmonary surfactant associated protein; 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; Collectin 4; Collectin-4; FLJ50593; FLJ51913; FLJ61144; FLJ77898,; FLJ79095; FLJ99559; MGC133365; MGC198590; OTTHUMP00000019928; OTTHUMP00000019929; OTTHUMP00000019930; OTTHUMP00000019931; PSAP; PSP A; PSP-A; PSPA; pulmonary surfactant -associated protein, 35-KD; pulmonary surfactant apoprotein PSP-A; pulmonary surfactant associated protein A1; Pulmonary surfactant-associated protein A1; SFTA1_HUMAN; SFTP1; SFTPA1; SFTPA1B; SP A; SP A1; SP-A; SP-A1; SPA; SPA1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant, pulmonary associated protein A1A; surfactant, pulmonary associated protein A1B; surfactant-associated protein, pulmonary 1; surfactant protein A1/surfactant protein A2], [SFTPA2; SFTPA2; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SPAII; COLEC5; SFTPA2B; COLEC5; PSAP; SFTP1; SFTPA; SFTPA2B; PSP-A; PSPA; SP-A; SP-A2] |
| Gene, Accession # | [SFTPA1/2], Gene ID: 729238, NCBI: NP_001092138.1, UniProt: Q8IWL1 |
| Catalog # | MBS177722 |
| Price | $315 |
| Order / More Info | SFTPA1/2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Perez-Gil J, Weaver TE (June 2010). Pulmonary surfactant pathophysiology: current models and open questions.Physiology (Bethesda) 25 (3): 132-41. 2. Phelps DS (2001). Surfactant regulation of host defense function in the lung: a question of balance. Pediatr Pathol Mol Med 20 (4): 269-92. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies