CD46 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CD46 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CD46 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Membrane cofactor protein(CD46) detection. Tested with WB in Mouse. Background: CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) and Membrane Cofactor Protein, is a protein which in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseri |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids. Ig Type: Rabbit IgG |
| Other Names | [Membrane cofactor protein; AHUS2; Antigen defined by; TRA 2 10; Antigen identified by; TRA 2 10; CD46; CD46 antigen; CD46 antigen complement regulatory protein; CD46 molecule; CD46 molecule complement regulatory protein; Complement membrane cofactor protein; MCP; MCP_HUMAN; Measles virus receptor; membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen); Membrane cofactor protein; MGC26544; MIC10; TLX; TRA2.10; Trophoblast leucocyte common antigen; Trophoblast leukocyte common antigen; Trophoblast lymphocyte cross reactive antigen; CD46 molecule, complement regulatory protein], [Cd46; Cd46; Mcp; Mcp] |
| Gene, Accession # | [CD46], Gene ID: 17221, NCBI: NP_034908.1, UniProt: O88174 |
| Catalog # | MBS177909 |
| Price | $280 |
| Order / More Info | CD46 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: CD46 CD46 molecule, complement regulatory protein. 2. Liszewski MK, Post TW, Atkinson JP (1991). Membrane cofactor protein (MCP or CD46): newest member of the regulators of complement activation gene cluster.Annu. Rev. Immunol. 9 (1): 431-55. 3. Taylor CT, Biljan MM, Kingsland CR, Johnson PM (May 1994). Inhibition of human spermatozoon-oocyte interaction in vitro by monoclonal antibodies to CD46 (membrane cofactor protein). Hum. Reprod.9 (5): 907-11. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies