IDH1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IDH1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IDH1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human;Mouse; Rat. Background: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytos |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [Isocitrate dehydrogenase [NADP] cytoplasmic; Cytosolic NADP isocitrate dehydrogenase; Cytosolic NADP-isocitrate dehydrogenase; Epididymis luminal protein 216; Epididymis secretory protein Li 26; HEL-216; HEL-S-26; ICDH; IDCD; IDH; IDH1; IDHC_HUMAN; IDP; IDPC; Isocitrate dehydrogenase [NADP] cytoplasmic; Isocitrate dehydrogenase 1 (NADP+) soluble; NADP dependent isocitrate dehydrogenase cytosolic; NADP dependent isocitrate dehydrogenase peroxisomal; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; PICD; isocitrate dehydrogenase 1 (NADP+), soluble], [IDH1; IDH1; IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26; PICD; IDH] |
| Gene, Accession # | [IDH1], Gene ID: 3417, NCBI: NP_001269315.1, UniProt: O75874 |
| Catalog # | MBS177879 |
| Price | $315 |
| Order / More Info | IDH1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: Isocitrate dehydrogenase 1 (NADP ), soluble. 2. Watanabe T, Nobusawa S, Kleihues P, Ohgaki H (April 2009). IDH1 mutations are early events in the development of astrocytomas and oligodendrogliomas.. Am J Pathol. 174 issue = 4 (4): 1149-53. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies