LRTOMT Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-LRTOMT antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | LRTOMT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for LRTOMT detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Leucine rich transmembrane and O-methyltransferase domain containing is a protein that in humans is encoded by the LRTOMT gene. It is mapped to 11q13.4. This gene has evolved in primates as a fusion of two ancestral neighboring genes, Lrrc51 and Tomt, which exist as two independent genes in rodents. The fusion gene contains some shared exons, but encodes structurally unrelated proteins, LRTOMT1 and LRTOMT2. Those variants that utilize the more centromere-proximal 3' terminal exon (short transcript form) encode LRTOMT1, while those variants that use a more centr |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL). |
| Other Names | [Transmembrane O-methyltransferase; Catechol O-methyltransferase 2; Protein LRTOMT2; LRTOMT; COMT2] |
| Gene, Accession # | [LRTOMT], Gene ID: 220074, NCBI: NP_001138780.1, UniProt: Q8WZ04 |
| Catalog # | MBS1752876 |
| Price | $315 |
| Order / More Info | LRTOMT Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Charif M, Bounaceur S, Abidi O, Nahili H, Rouba H, Kandil M, Boulouiz R, Barakat A (December 2012). The c.242G>A mutation in LRTOMT gene is responsible for a high prevalence of deafness in the Moroccan population. Molecular Biology Reports. 39 (12): 11011-6. 2. Entrez Gene: Leucine rich transmembrane and O-methyltransferase domain containing 3. Riahi Z, Bonnet C, Zainine R, Louha M, Bouyacoub Y, Laroussi N, Chargui M, Kefi R, Jonard L, Dorboz I, Hardelin JP, Salah SB, Levilliers J, Weil D, McElreavey K, Boespflug OT, Besbes G, Abdelhak S, Petit C (2014). Whole exome sequencing identifies new causative mutations in Tunisian families with non-syndromic deafness. PLoS One. 9 (6): e99797. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies