Edit |   |
---|---|
Antigenic Specificity | TRPV6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.88 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a member of a family of multipass membrane proteins that functions as calcium channels. The encoded protein contains N-terminal ankyrin repeats, which are required for channel assembly and regulation. Translation initiation for this protein occurs at a non-AUG start codon that is decoded as methionine. This gene is situated next to a closely related gene for transient receptor potential cation channel subfamily V member 5 (TRPV5). This locus has experienced positive selection in non-African populations, resulting in several non-synonymous codon differences among individuals of different genetic backgrounds. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRPV6 (NP 061116.5). Immunogen Sequence: MGPLQGDGGPALGGADVAPRLSPVRVWPRPQAPKEPALHPMGLSLPKEKGLILCLWSKFCRWFQRRESWAQSRDEQNLLQQKRIWESPLLLAAKDNDVQA |
Other Names | [TRPV6; ABP/ZF; CAT1; CATL; ECAC2; HSA277909; LP6728; ZFAB; transient receptor potential cation channel subfamily V member 6] |
Gene, Accession # | [TRPV6], NCBI: Q9H1D0.2, UniProt: Q9H1D0 |
Catalog # | MBS9140732 |
Price | $260 |
Order / More Info | TRPV6 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |