Edit |   |
---|---|
Antigenic Specificity | RBMS3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 1.68 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 334-433 of human RBMS3 (NP 001171183.1). Immunogen Sequence: MDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK |
Other Names | [RBMS3; RNA binding motif single stranded interacting protein 3] |
Gene, Accession # | [RBMS3], Gene ID: 27303, NCBI: Q6XE24.1, UniProt: Q6XE24 |
Catalog # | MBS9141052 |
Price | $260 |
Order / More Info | RBMS3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |