Edit |   |
---|---|
Antigenic Specificity | UNC5A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal UNC5A antibody |
Immunogen | Immunogen: UNC5A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT |
Other Names | [UNC5A; UNC5A; KIAA1976; UNCA 5; UNCA-5; UNC5H1; FLJ16449; Unc-5 Homolog A; UNC5A] |
Gene, Accession # | [UNC5A], Gene ID: 799734, NCBI: ABB59709.1 |
Catalog # | MBS5300443 |
Price | $430 |
Order / More Info | UNC5A Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |