Edit |   |
---|---|
Antigenic Specificity | IL10R Alpha |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: IL10R Alpha antibody was raised against the N terminal of IL10RA. Rabbit polyclonal IL10R Alpha antibody raised against the N terminal of IL10RA |
Immunogen | Immunogen: IL10R Alpha antibody was raised using the N terminal of IL10RA corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN |
Other Names | [IL10R Alpha; IL10R Alpha; IL10; IL-10; Interleukin 10 Receptor Alpha; CDW210A; IL10R; HIL-10R; IL 10; IL10RA; IL-10R1] |
Gene, Accession # | [IL10R Alpha], Gene ID: 3587, NCBI: NP_001549.2 |
Catalog # | MBS5303188 |
Price | $355 |
Order / More Info | IL10R Alpha Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |