Aquaporin 9 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Aquaporin 9 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Aquaporin 9 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Aquaporin-9 is a protein that in humans is encoded by the AQP9 gene. AQP9 encodes a 295-amino-acid protein with the amino acid sequence identity with AQP3 (48%), AQP7 (45%), and other aquaporins (approximately 30%), suggesting that AQP3, AQP7, and AQP9 belong to a subfamily of the aquaporin family. AQP9 is the major glycerol channel in mouse erythrocytes and suggest that this transport pathway may contribute to the virulence of intraerythrocytic stages of malarial infection. Protein Function: Forms a channel with a broad specificity. Mediates passage of a wide variety of non-charged solutes including carbamides, polyols, purines, and pyrimidines in a phloretin- and mercury-sensitive manner, whereas amino acids, cyclic sugar |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Aquaporin 9 (LVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM). Subcellular Localization: Membrane; Multi-pass membrane protein. Tissue Specificity: Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen. |
| Other Names | [Aquaporin-9; AQP-9; Aquaglyceroporin-9; Small solute channel 1; AQP9; SSC1] |
| Gene, Accession # | [AQP9], Gene ID: 366, NCBI: NP_066190.2, UniProt: O43315 |
| Catalog # | MBS1750848 |
| Price | $280 |
| Order / More Info | Aquaporin 9 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies