Ace/Cd143 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Ace/Cd143 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Ace/Cd143 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascu |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR). Subcellular Localization: Angiotensin-converting enzyme, soluble form: Secreted. Tissue Specificity: Testis-specific isoform is expressed in spermatocytes, adult testis. |
| Other Names | [Angiotensin-converting enzyme; ACE; Dipeptidyl carboxypeptidase I; Kininase II; CD143; Angiotensin-converting enzyme, soluble form; Ace; Dcp1] |
| Gene, Accession # | [Ace/Cd143], Gene ID: 11421, NCBI: NP_033728.1, UniProt: P09470 |
| Catalog # | MBS1750358 |
| Price | $280 |
| Order / More Info | Ace/Cd143 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies