UNC5C Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-UNC5C antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | UNC5C |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Netrin receptor UNC5C(UNC5C) detection. Tested with WB in Human;Mouse;Rat. Background: Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondi |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Netrin receptor UNC5C; homolog of C. elegans transmembrane receptor Unc5; Netrin receptor UNC5C; Protein unc 5 homolog C; Protein unc-5 homolog 3; Protein unc-5 homolog C; Unc 5 homolog 3; Unc 5 homolog C; Unc5 (C.elegans homolog) c; Unc5c; UNC5C_HUMAN; UNC5H3; unc-5 netrin receptor C], [UNC5C; UNC5C; UNC5H3; UNC5H3] |
| Gene, Accession # | [UNC5C], Gene ID: 8633, NCBI: NP_003719.3, UniProt: O95185 |
| Catalog # | MBS178352 |
| Price | $280 |
| Order / More Info | UNC5C Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: UNC5C unc-5 homolog C (C. elegans). 2. Ackerman SL, Knowles BB (Dec 1998). Cloning and mapping of the UNC5C gene to human chromosome 4q21-q23.Genomics 52 (2): 205-8. 3. Leonardo ED, Hinck L, Masu M, Keino-Masu K, Ackerman SL, Tessier-Lavigne M (May 1997). Vertebrate homologues of C. elegans UNC-5 are candidate netrin receptors. Nature 386 (6627): 833-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies