Edit |   |
---|---|
Antigenic Specificity | RPS6 |
Clone | [2H7] |
Host Species | Mouse |
Reactive Species | human, mouse, rat |
Isotype | IgG1 |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Immunofluorescence (IF) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: No cross reactivity with other proteins. Description: Mouse IgG monoclonal antibody for RPS6 detection. Tested with Tested with WB, IHC-P, IHC-F, ICC/IF in Human; Mouse; Rat.Background: Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protei |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences. |
Other Names | [40S ribosomal protein S6; Phosphoprotein NP33; Small ribosomal subunit protein eS6; RPS6; OK/SW-cl.2; Ribosomal protein S6] |
Gene, Accession # | [RPS6], Gene ID: 6194, NCBI: NP_001001.2, UniProt: P62753 |
Catalog # | MBS1752106 |
Price | $315 |
Order / More Info | RPS6 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Magnuson B1, Ekim B, Fingar DC (2012). Regulation and function of ribosomal protein S6 kinase (S6K) within mTOR signalling networks. Biochemical Journal. 441 (1): 1-21. |