PPT1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PPT1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PPT1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Palmitoyl-protein thioesterase 1(PPT1) detection. Tested with WB, IHC-P in Human;Rat. Background: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcr |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids. Ig Type: Rabbit IgG |
| Other Names | [Palmitoyl-protein thioesterase 1; Ceroid palmitoyl palmitoyl protein thioesterase 1; CLN1; EC 3.1.2.22; INCL; Palmitoyl protein hydrolase 1; Palmitoyl protein thioesterase 1; Palmitoyl-protein hydrolase 1; Palmitoyl-protein thioesterase 1; PPT; PPT-1; PPT1; PPT1_HUMAN; palmitoyl-protein thioesterase 1], [PPT1; PPT1; PPT; CLN1; INCL; PPT; PPT-1] |
| Gene, Accession # | [PPT1], Gene ID: 5538, NCBI: NP_000301.1, UniProt: P50897 |
| Catalog # | MBS178109 |
| Price | $315 |
| Order / More Info | PPT1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: palmitoyl-protein thioesterase 1. 2. Hellsten E, Vesa J, Speer MC, Makela TP, Jarvela I, Alitalo K, Ott J, Peltonen L (June 1993). Refined assignment of the infantile neuronal ceroid lipofuscinosis (INCL, CLN1) locus at 1p32: incorporation of linkage disequilibrium in multipoint analysis. Genomics 16 (3): 720-5. 3. Vesa J, Hellsten E, Verkruyse LA, Camp LA, Rapola J, Santavuori P, Hofmann SL, Peltonen L (August 1995). Mutations in the palmitoyl protein thioesterase gene causing infantile neuronal ceroid lipofuscinosis.Nature 376 (6541): 584-7. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies