MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) |
| Clone | [2F6] |
| Host Species | Mouse |
| Reactive Species | human. |
| Isotype | IgG2a, kappa |
| Format | unconjugated |
| Size | 0.02 mg (With BSA & Azide at 0.2mg/ml), 0.1 mg (With BSA & Azide at 0.2mg/ml), 0.1 mg (Without BSA & Azide at 1mg/ml) |
| Concentration | n/a |
| Applications | Flow Cytometry (FC/FACS), Immunofluorescence (IF), Western Blot (WB), Immunohistochemistry (IHC) Formalin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF-kB pathway, CHUK and IKBKB. Additionally, MEK |
| Immunogen | Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
| Other Names | [MEKK1; MEK Kinase 1; MEKK; SRXY6; MAPKKK1], [MAP3K1; MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1; MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1] |
| Gene, Accession # | [MAP3K1], Gene ID: 4214, NCBI: NP_005912.1, UniProt: Q13233 |
| Catalog # | MBS439590 |
| Price | $190, $340, $340 |
| Order / More Info | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody from MYBIOSOURCE INC. |
| Product Specific References | Guan, K.L. 1994. The mitogen activated protein kinase signal transduction pathway: from the cell surface to the nucleus. Cell. Signal. 6: 581-589 |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies