Annexin VII Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Annexin VII antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Annexin VII |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Annexin A7(ANXA7) detection. Background: ANXA7 (Annexin A7), also known as ANX7 or SNX, is a protein that in humans is encoded by the ANXA7 gene. Annexin VII is a member of the annexin family of calcium-dependent phospholipid binding proteins. This gene is mapped to 10q21.1-q21.2 by study of somatic cell hybrids and by in situ hybridization. The ANX7 gene exhibits many biologic and genetic properties expected of a tumor suppressor gene and may play a role in prostate cancer progression. Based on studies of recombinant human ANXA7 and isolated bovine chromaffin cells, it is showed that ANXA7 is a Ca(2+)-dependent GTP binding protein. ANXA7 was active in a chromaffin granule aggregation assays in the presenc |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid. |
| Other Names | [Annexin A7; Annexin-7; ANX7; ANX7; SNX; ANXA7; P20073; Synexin; Annexin VII], [ANXA7; ANXA7; SNX; ANX7; SYNEXIN; ANX7; SNX] |
| Gene, Accession # | [ANXA7], Gene ID: 310, NCBI: NP_001147.1, UniProt: P20073 |
| Catalog # | MBS178691 |
| Price | $280 |
| Order / More Info | Annexin VII Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Caohuy, H., Srivastava, M., Pollard, H. B. Membrane fusion protein synexin (annexin VII) as a Ca(2 )/GTP sensor in exocytotic secretion. Proc. Nat. Acad. Sci. 93: 10797-10802, 1996.2. Shirvan, A., Srivastava, M., Wang, M. G., Cultraro, C., Magendzo, K., McBride, O. W., Pollard, H. B., Burns, A. L. Divergent structure of the human synexin (annexin VII) gene and assignment to chromosome 10. Biochemistry 33: 6888-6901, 1994.3. Srivastava, M., Bubendorf, L., Srikantan, V., Fossom, L., Nolan, L., Glasman, M., Leighton, X., Fehrle, W., Pittaluga, S., Raffeld, M., Koivisto, P., Willi, N., Gasser, T. C., Kononen, J., Sauter, G., Kallioniemi, O. P., Srivastava, S., Pollard, H. B. ANX7, a candidate tumor suppressor gene for prostate cancer. Proc. Nat. Acad. Sci. 98: 4575-4580, 2001. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies