TRIF Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TRIF antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TRIF |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for TIR domain-containing adapter molecule 1(TICAM1) detection. Tested with WB in Mouse. Background: TICAM1 (TIR DOMAIN-CONTAINING ADAPTOR MOLECULE 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs). It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse TRIF (53-84aa QDTEARVSLESLKMNTVAQLVAHQWADMETTE), different from the related human sequence by twelve amino acids. Ig Type: Rabbit IgG |
| Other Names | [TIR domain-containing adapter molecule 1; MGC35334; Proline rich vinculin and TIR domain containing protein B; Proline-rich; PRVTIRB; Putative NF kappa B activating protein 502H; Putative NF-kappa-B-activating protein 502H; Putative NFkB activating protein; TCAM1_HUMAN; TICAM 1; TICAM-1; TICAM1; TIR domain containing adapter molecule 1; TIR domain containing adapter protein inducing IFN beta; TIR domain containing adaptor inducing interferon beta; TIR domain-containing adapter molecule 1; TIR domain-containing adapter protein inducing IFN-beta; Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta; Toll like receptor adaptor molecule 1; Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; TRIF; TRIF protein; vinculin and TIR domain-containing protein B; toll-like receptor adaptor molecule 1], [Ticam1; Ticam1; TRIF; TICAM-1; AW046014; AW547018; Trif; TICAM-1; TIR domain-containing adapter protein inducing IFN-beta] |
| Gene, Accession # | [TRIF], Gene ID: 106759, NCBI: NP_778154.1, UniProt: Q80UF7 |
| Catalog # | MBS178058 |
| Price | $280 |
| Order / More Info | TRIF Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Carty, M., Goodbody, R., Schroder, M., Stack, J., Moynagh, P. N., Bowie, A. G.The human adaptor SARM negatively regulates adaptor protein TRIF-dependent Toll-like receptor signaling.Nature Immun. 7: 1074-1081, 2006. 2. Oshiumi, H., Matsumoto, M., Funami, K., Akazawa, T., Seya, T.TICAM-I, an adaptor molecule that participates in Toll-like receptor 3-mediated interferon-beta induction.Nature Immun. 4: 161-167, 2003. 3. Yamamoto, M., Sato, S., Mori, K., Hoshino, K., Takeuchi, O., Takeda, K., Akira, S.Cutting edge: a novel Toll/IL-1 receptor domain-containing adapter that preferentially activates the IFN-beta promoter in the Toll-like receptor signaling.J. Immun. 169: 6668-6672, 2002. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies